STOML2 Peptide - C-terminal region
STOML2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
HSPC108, SLP-2
UniProt
Q9UJZ1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with STOML2 Rabbit Polyclonal Antibody (orb585120) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_038470
Preservative
Lyophilized powder
AA Sequence
VTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
16537-AAT 200 µg
IFluor® 546 goat anti-mouse IgG (H+L) *Cross Adsorbed*
Sign In for Pricing
View Details 
E-UNEL-H0321-01 5x 96 Tests
Uncoated Human MFGE8 (Milk Fat Globule EGF Factor 8) ELISA Kit
Sign In for Pricing
View Details E-UNEL-H0321-02 15x 96 Tests
Uncoated Human MFGE8 (Milk Fat Globule EGF Factor 8) ELISA Kit
Sign In for Pricing
View Details