Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CENPX Peptide - middle region

CENPX Peptide - middle region

Product Specifications

Product Name Alternative

D9, MHF2, CENP-X, FAAP10, STRA13

UniProt

A8MT69

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CENPX Rabbit Polyclonal Antibody (orb325786) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659435

Preservative

Lyophilized powder

AA Sequence

MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), Biotin conjugate, 0.1mg/mL
BNCB0225-500 1x 500 µL

Major Vault Protein (MVP) (1032), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Activin Receptor Type IIA (ACVR2A) Mouse Monoclonal Antibody [Clone ID: OTI5D1]
CF807410 100 µg

Activin Receptor Type IIA (ACVR2A) Mouse Monoclonal Antibody [Clone ID: OTI5D1]

Sign In for Pricing
View Details
TOX2 (NM_001098796) Human Over-expression Lysate
LY420333 100 µg

TOX2 (NM_001098796) Human Over-expression Lysate

Sign In for Pricing
View Details
Parathyroid Hormone Recombinant Rabbit Monoclonal Antibody [JE66-58]
HA722059 100 µL

Parathyroid Hormone Recombinant Rabbit Monoclonal Antibody [JE66-58]

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL
BNC040977-500 1x 500 µL

TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM131C Mouse Monoclonal Antibody [Clone ID: OTI6G2]
CF810783 100 µg

FAM131C Mouse Monoclonal Antibody [Clone ID: OTI6G2]

Sign In for Pricing
View Details