Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX4 Peptide - C-terminal region

STX4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

STX4A, p35-2

UniProt

Q12846

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STX4 Rabbit Polyclonal Antibody (orb584368) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004595

Preservative

Lyophilized powder

AA Sequence

VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA DOB (HLA-DOB) (NM_002120) Human Recombinant Protein
TP302892M 100 µg

HLA DOB (HLA-DOB) (NM_002120) Human Recombinant Protein

Sign In for Pricing
View Details
Sheep 1, 3-beta-D-glucosidase ELISA Kit
MBS748752-01 48 Well

Sheep 1, 3-beta-D-glucosidase ELISA Kit

Sign In for Pricing
View Details
Sheep 1, 3-beta-D-glucosidase ELISA Kit
MBS748752-02 96 Well

Sheep 1, 3-beta-D-glucosidase ELISA Kit

Sign In for Pricing
View Details
Sheep 1, 3-beta-D-glucosidase ELISA Kit
MBS748752-03 5x 96 Well

Sheep 1, 3-beta-D-glucosidase ELISA Kit

Sign In for Pricing
View Details
Sheep 1, 3-beta-D-glucosidase ELISA Kit
MBS748752-04 10x 96 Well

Sheep 1, 3-beta-D-glucosidase ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal INSM1 Antibody (INSM1/8149R) [HRP]
NBP3-20708H 0.1 mL

Rabbit Monoclonal INSM1 Antibody (INSM1/8149R) [HRP]

Sign In for Pricing
View Details