Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX4 Peptide - middle region

STX4 Peptide - middle region

Product Specifications

Product Name Alternative

STX4A, p35-2

UniProt

Q12846

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STX4 Rabbit Polyclonal Antibody (orb584369) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004595

Preservative

Lyophilized powder

AA Sequence

LKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myelin Basic Protein (MBP) (NM_001025081) Human Over-expression Lysate
LY422581 100 µg

Myelin Basic Protein (MBP) (NM_001025081) Human Over-expression Lysate

Sign In for Pricing
View Details
RED1 (ADARB1) Rabbit Polyclonal Antibody
AP06707PU-N 100 µg

RED1 (ADARB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERp57 Antibody
KC-29411-01 50 μL

ERp57 Antibody

Sign In for Pricing
View Details
ERp57 Antibody
KC-29411-02 100 µL

ERp57 Antibody

Sign In for Pricing
View Details
ERp57 Antibody
KC-29411-03 1 mL

ERp57 Antibody

Sign In for Pricing
View Details
1-Isocyanato-3-phenoxybenzene
TRC-I809160-1G 1 g

1-Isocyanato-3-phenoxybenzene

Sign In for Pricing
View Details