Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX4 Peptide - middle region

STX4 Peptide - middle region

Product Specifications

Product Name Alternative

STX4A, p35-2

UniProt

Q12846

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STX4 Rabbit Polyclonal Antibody (orb584369) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004595

Preservative

Lyophilized powder

AA Sequence

LKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENTPD1 Polyclonal Antibody
E-AB-53347-01 20 µL

ENTPD1 Polyclonal Antibody

Sign In for Pricing
View Details
ENTPD1 Polyclonal Antibody
E-AB-53347-02 60 µL

ENTPD1 Polyclonal Antibody

Sign In for Pricing
View Details
ENTPD1 Polyclonal Antibody
E-AB-53347-03 120 µL

ENTPD1 Polyclonal Antibody

Sign In for Pricing
View Details
ENTPD1 Polyclonal Antibody
E-AB-53347-04 200 µL

ENTPD1 Polyclonal Antibody

Sign In for Pricing
View Details
Rat CCL2/MCP-1, Tag Free
HA211114-01 20 µg

Rat CCL2/MCP-1, Tag Free

Sign In for Pricing
View Details
Rat CCL2/MCP-1, Tag Free
HA211114-02 50 µg

Rat CCL2/MCP-1, Tag Free

Sign In for Pricing
View Details