Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STYXL1 Peptide - middle region

STYXL1 Peptide - middle region

Product Specifications

Product Name Alternative

DUSP24, MK-STYX

UniProt

Q9Y6J8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STYXL1 Rabbit Polyclonal Antibody (orb326338) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057170

Preservative

Lyophilized powder

AA Sequence

FLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Interleukin 1 Beta (IL1b) ELISA Kit
RDR-IL1b-c-01 96 Tests

Canine Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
Canine Interleukin 1 Beta (IL1b) ELISA Kit
RDR-IL1b-c-02 48 Tests

Canine Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
Acridine orange *10 mg/mL solution in water*
17503-AAT 10 mL

Acridine orange *10 mg/mL solution in water*

Sign In for Pricing
View Details
Synaptogyrin 3 (SYNGR3) (C-term) Rabbit Polyclonal Antibody
AP23936PU-N 50 µg

Synaptogyrin 3 (SYNGR3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
YBX1 Polyclonal Antibody
E-AB-66539-01 60 µL

YBX1 Polyclonal Antibody

Sign In for Pricing
View Details
YBX1 Polyclonal Antibody
E-AB-66539-02 120 µL

YBX1 Polyclonal Antibody

Sign In for Pricing
View Details