Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STYXL1 Peptide - middle region

STYXL1 Peptide - middle region

Product Specifications

Product Name Alternative

DUSP24, MK-STYX

UniProt

Q9Y6J8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STYXL1 Rabbit Polyclonal Antibody (orb326338) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057170

Preservative

Lyophilized powder

AA Sequence

FLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR56A4 activation kit by CRISPRa
GA114726 1 Kit

Human OR56A4 activation kit by CRISPRa

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing's Sarcoma Marker) (NX2/2198R), CF488A conjugate, 0.1mg/mL
BNC882198-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing's Sarcoma Marker) (NX2/2198R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse E-Cad (E-Cadherin) ELISA Kit
E-EL-M0211-01 24 Tests

Mouse E-Cad (E-Cadherin) ELISA Kit

Sign In for Pricing
View Details
Mouse E-Cad (E-Cadherin) ELISA Kit
E-EL-M0211-02 48 Tests

Mouse E-Cad (E-Cadherin) ELISA Kit

Sign In for Pricing
View Details
Mouse E-Cad (E-Cadherin) ELISA Kit
E-EL-M0211-03 96 Tests

Mouse E-Cad (E-Cadherin) ELISA Kit

Sign In for Pricing
View Details
Slc2a2 Rabbit Polyclonal Antibody
TA396527S 25 µL

Slc2a2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details