Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUGT1 Peptide - middle region

SUGT1 Peptide - middle region

Product Specifications

Product Name Alternative

SGT1

UniProt

A8K7W3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SUGT1 Rabbit Polyclonal Antibody (orb581629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006695

Preservative

Lyophilized powder

AA Sequence

YTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COPE Antibody
E30AC2722 100 µL

COPE Antibody

Sign In for Pricing
View Details
CJUN antibody
10R-10675 0.1 mg

CJUN antibody

Sign In for Pricing
View Details
IFNA1 Antibody
KC-520-01 50 μL

IFNA1 Antibody

Sign In for Pricing
View Details
IFNA1 Antibody
KC-520-02 100 µL

IFNA1 Antibody

Sign In for Pricing
View Details
IFNA1 Antibody
KC-520-03 1 mL

IFNA1 Antibody

Sign In for Pricing
View Details
HIF1AN/FIH-1 Antibody [N1M12]
C15432-01 20 µL

HIF1AN/FIH-1 Antibody [N1M12]

Sign In for Pricing
View Details