Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUGT1 Peptide - middle region

SUGT1 Peptide - middle region

Product Specifications

Product Name Alternative

SGT1

UniProt

A8K7W3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SUGT1 Rabbit Polyclonal Antibody (orb581629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006695

Preservative

Lyophilized powder

AA Sequence

YTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Galectin 8 ELISA kit
GTR10412709 96 Well

Sheep Galectin 8 ELISA kit

Sign In for Pricing
View Details
Recombinant Mouse AZGP1 Protein, N-His
bs-106495P-01 20 µg

Recombinant Mouse AZGP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse AZGP1 Protein, N-His
bs-106495P-02 50 µg

Recombinant Mouse AZGP1 Protein, N-His

Sign In for Pricing
View Details
Sqstm1 (Sequestosome-1, STONE14, Ubiquitin-Binding Protein p62, Sqstm1, A170, STAP) (MaxLight 650) discontinued
302770-ML650 100 µL

Sqstm1 (Sequestosome-1, STONE14, Ubiquitin-Binding Protein p62, Sqstm1, A170, STAP) (MaxLight 650) discontinued

Sign In for Pricing
View Details
DEPDC7 Polyclonal Conjugated Antibody
MBS9441363-01 0.1 mL (Biotin)

DEPDC7 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DEPDC7 Polyclonal Conjugated Antibody
MBS9441363-02 0.1 mL (AF350)

DEPDC7 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details