Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sult1c2 Peptide - middle region

Sult1c2 Peptide - middle region

Product Specifications

Product Name Alternative

MGC112625, MGC124969, ST1C2

UniProt

Q9WUW8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sult1c2 Rabbit Polyclonal Antibody (orb580656) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598231

Preservative

Lyophilized powder

AA Sequence

KCQRTIIQHRHPFIEWARPPQPSGVDKANAMPAPRILRTHLPTQLLPPSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella flexneri Uncharacterized protein ydhZ (ydhZ)
MBS1227013-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri Uncharacterized protein ydhZ (ydhZ)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Uncharacterized protein ydhZ (ydhZ)
MBS1227013-02 0.1 mg (E-Coli)

Recombinant Shigella flexneri Uncharacterized protein ydhZ (ydhZ)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Uncharacterized protein ydhZ (ydhZ)
MBS1227013-03 0.02 mg (Yeast)

Recombinant Shigella flexneri Uncharacterized protein ydhZ (ydhZ)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Uncharacterized protein ydhZ (ydhZ)
MBS1227013-04 0.1 mg (Yeast)

Recombinant Shigella flexneri Uncharacterized protein ydhZ (ydhZ)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Uncharacterized protein ydhZ (ydhZ)
MBS1227013-05 0.02 mg (Baculovirus)

Recombinant Shigella flexneri Uncharacterized protein ydhZ (ydhZ)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Uncharacterized protein ydhZ (ydhZ)
MBS1227013-06 1 mg (E-Coli)

Recombinant Shigella flexneri Uncharacterized protein ydhZ (ydhZ)

Sign In for Pricing
View Details