Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1E1 Peptide - middle region

SULT1E1 Peptide - middle region

Product Specifications

Product Name Alternative

EST, EST-1, MGC34459, STE, ST1E1

UniProt

P49888

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SULT1E1 Rabbit Polyclonal Antibody (orb580481) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005411

Preservative

Lyophilized powder

AA Sequence

LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNRD2 Rabbit Polyclonal Antibody
TA366153 100 µL

ZNRD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3-Hydroxy Benzopyrene O-Beta-D-glucuronide
TRC-H829405-10MG 10 mg

3-Hydroxy Benzopyrene O-Beta-D-glucuronide

Sign In for Pricing
View Details
Colloidal Gold Labeled Horseradish Peroxidase, 1mL 30nm
GP-03-30 1 mL

Colloidal Gold Labeled Horseradish Peroxidase, 1mL 30nm

Sign In for Pricing
View Details
HDGFL3 (NM_016073) Human Over-expression Lysate
LY402497 100 µg

HDGFL3 (NM_016073) Human Over-expression Lysate

Sign In for Pricing
View Details
Human OcULar development associated gene (GATAD1) activation kit by CRISPRa
GA111729 1 Kit

Human OcULar development associated gene (GATAD1) activation kit by CRISPRa

Sign In for Pricing
View Details
Nor Cholic Acid
TRC-N661440-50MG 50 mg

Nor Cholic Acid

Sign In for Pricing
View Details