Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1E1 Peptide - middle region

SULT1E1 Peptide - middle region

Product Specifications

Product Name Alternative

EST, EST-1, MGC34459, STE, ST1E1

UniProt

P49888

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SULT1E1 Rabbit Polyclonal Antibody (orb580481) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005411

Preservative

Lyophilized powder

AA Sequence

LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HP1 alpha (CBX5) (NM_001127322) Human Over-expression Lysate
LY426745 100 µg

HP1 alpha (CBX5) (NM_001127322) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Chloroadenosine-2’,3’-acetonide
TRC-C363860-50MG 50 mg

2-Chloroadenosine-2’,3’-acetonide

Sign In for Pricing
View Details
Phytic Acid Dodecasodium Salt Hydrate
TRC-P398713-5G 5 g

Phytic Acid Dodecasodium Salt Hydrate

Sign In for Pricing
View Details
PRAMEF5 (NM_001013407) Human Over-expression Lysate
LC422970 20 µg

PRAMEF5 (NM_001013407) Human Over-expression Lysate

Sign In for Pricing
View Details
Caftaric Acid
TRC-C083000-25MG 25 mg

Caftaric Acid

Sign In for Pricing
View Details
CNTF Receptor alpha (CNTFR) Human Gene Knockout Kit (CRISPR)
KN400487 1 Kit

CNTF Receptor alpha (CNTFR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details