Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMT5B Peptide - C-terminal region

KMT5B Peptide - C-terminal region

Product Specifications

Product Name Alternative

AA117471, Suv420h1, Suv4-20h1, C630029K18Rik

UniProt

Q3U8K7

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KMT5B Rabbit Polyclonal Antibody (orb325667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

NCBI Accession Number

NP_001161356

Preservative

Lyophilized powder

AA Sequence

FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROR2 (ROR2/1912), CF594 conjugate, 0.1mg/mL
BNC941912-100 1x 100 µL

ROR2 (ROR2/1912), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD25/ IL2RA (Activated Lymphocyte Marker) (IL2RA/2395), Biotin conjugate, 0.1mg/mL
BNCB2395-100 1x 100 µL

CD25/ IL2RA (Activated Lymphocyte Marker) (IL2RA/2395), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Di-2-thienylglycolic Acid
TRC-D493915-20MG 20 mg

Di-2-thienylglycolic Acid

Sign In for Pricing
View Details
CAPZA1 (NM_006135) Human Over-expression Lysate
LY401848 100 µg

CAPZA1 (NM_006135) Human Over-expression Lysate

Sign In for Pricing
View Details
(-)-8-Prenylnaringenin
TRC-P712890-10MG 10 mg

(-)-8-Prenylnaringenin

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS708463 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details