Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNC Peptide - C-terminal region

SYNC Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC149625, MGC149626, SYNC1, SYNCOILIN

UniProt

Q9H7C4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYNC Rabbit Polyclonal Antibody (orb585715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001155180

Preservative

Lyophilized powder

AA Sequence

MKEALRPLQAEARQLRLQNRNLEDQIALVRQKRDEEVQQYREQLEEMEER

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC682105 Protein Lysate (Rat) with C-HA Tag
27381036 100 µg

LOC682105 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
ARRDC2 Conjugated Antibody
C34168 100 µL

ARRDC2 Conjugated Antibody

Sign In for Pricing
View Details
Mouse Neuropilin 1 (NRP1) ELISA Kit
orb3012025-01 48 Tests

Mouse Neuropilin 1 (NRP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Neuropilin 1 (NRP1) ELISA Kit
orb3012025-02 96 Tests

Mouse Neuropilin 1 (NRP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Neuropilin 1 (NRP1) ELISA Kit
orb3012025-03 5 x 96 T

Mouse Neuropilin 1 (NRP1) ELISA Kit

Sign In for Pricing
View Details
Meis1 ORF Vector (Rat) (pORF)
28341016 1.0 µg DNA

Meis1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details