Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Synpr Peptide - middle region

Synpr Peptide - middle region

Product Specifications

Product Name Alternative

1500003F20Rik, SPO

UniProt

Q8BGN8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Synpr Rabbit Polyclonal Antibody (orb331048) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082328

Preservative

Lyophilized powder

AA Sequence

LVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ESX1, NT (ESX1, ESX1L, ESX1R, Homeobox protein ESX1, Extraembryonic, spermatogenesis, homeobox 1, Homeobox protein ESX1-N, Homeobox protein ESX1-C) (Azide free) (HRP) discontinued
035244-HRP 200 µL

ESX1, NT (ESX1, ESX1L, ESX1R, Homeobox protein ESX1, Extraembryonic, spermatogenesis, homeobox 1, Homeobox protein ESX1-N, Homeobox protein ESX1-C) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Fmoc-D-Asn (Trt) -OH
HY-W010719-01 5 g

Fmoc-D-Asn (Trt) -OH

Sign In for Pricing
View Details
Fmoc-D-Asn (Trt) -OH
HY-W010719-02 25 g

Fmoc-D-Asn (Trt) -OH

Sign In for Pricing
View Details
Mouse Monoclonal CD47 Antibody (IAP/964 + B6H12.2) [Biotin]
NBP2-47812B 0.1 mL

Mouse Monoclonal CD47 Antibody (IAP/964 + B6H12.2) [Biotin]

Sign In for Pricing
View Details
Rabbit Anti-MKLP1 antibody
SL9315R-01 50 µL

Rabbit Anti-MKLP1 antibody

Sign In for Pricing
View Details
Rabbit Anti-MKLP1 antibody
SL9315R-02 100 µL

Rabbit Anti-MKLP1 antibody

Sign In for Pricing
View Details