Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Synpr Peptide - middle region

Synpr Peptide - middle region

Product Specifications

Product Name Alternative

1500003F20Rik, SPO

UniProt

Q8BGN8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Synpr Rabbit Polyclonal Antibody (orb331048) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082328

Preservative

Lyophilized powder

AA Sequence

LVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Efna3 shRNA (UAS) - Lentiviral mouse Efna3 shRNA (UAS, RFP) plasmid
GTR15242377 1 Vial

Lentiviral mouse Efna3 shRNA (UAS) - Lentiviral mouse Efna3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Dus3l sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
18668114 3x 1.0 µg

Dus3l sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
BOLL (Bol, Boule-like (Drosophila)) (PE)
MBS6183978-01 0.1 mL

BOLL (Bol, Boule-like (Drosophila)) (PE)

Sign In for Pricing
View Details
BOLL (Bol, Boule-like (Drosophila)) (PE)
MBS6183978-02 5x 0.1 mL

BOLL (Bol, Boule-like (Drosophila)) (PE)

Sign In for Pricing
View Details
PIF1 Polyclonal Antibody
RD79667A-01 20 µL

PIF1 Polyclonal Antibody

Sign In for Pricing
View Details
PIF1 Polyclonal Antibody
RD79667A-02 60 μL

PIF1 Polyclonal Antibody

Sign In for Pricing
View Details