Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Syt1 Peptide - middle region

Syt1 Peptide - middle region

Product Specifications

Product Name Alternative

AW124717, G630098F17Rik, SytI

UniProt

P46096

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Syt1 Rabbit Polyclonal Antibody (orb331045) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_033332

Preservative

Lyophilized powder

AA Sequence

FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAGE1 Mouse Monoclonal Antibody [Clone ID: OTI13B1]
TA805801 100 µL

PAGE1 Mouse Monoclonal Antibody [Clone ID: OTI13B1]

Sign In for Pricing
View Details
ZBTB49 siRNA (Mouse)
orb1839913-01 15 nmol

ZBTB49 siRNA (Mouse)

Sign In for Pricing
View Details
ZBTB49 siRNA (Mouse)
orb1839913-02 30 nmol

ZBTB49 siRNA (Mouse)

Sign In for Pricing
View Details
Cladribine
S1199-10mM/1mL 10 mM/1mL

Cladribine

Sign In for Pricing
View Details
Lysozyme (LYZ) Mouse Monoclonal Antibody [Clone ID: OTI1D8]
TA506192S 30 µL

Lysozyme (LYZ) Mouse Monoclonal Antibody [Clone ID: OTI1D8]

Sign In for Pricing
View Details
NTMT1 Knockout jurkat Polyclonal Cells
ARG13186 1 Million

NTMT1 Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details