SYT11 Peptide - N-terminal region
SYT11 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DKFZp781D015, KIAA0080, MGC10881, MGC17226, SYT12, sytXI
UniProt
Q9BT88
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SYT11 Rabbit Polyclonal Antibody (orb584347) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689493
Preservative
Lyophilized powder
AA Sequence
AGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941925-100 1x 100 µL
P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682099-500 1x 500 µL
Catenin, beta (p120) (CTNNB1/2099), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details