Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT11 Peptide - N-terminal region

SYT11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp781D015, KIAA0080, MGC10881, MGC17226, SYT12, sytXI

UniProt

Q9BT88

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYT11 Rabbit Polyclonal Antibody (orb584348) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689493

Preservative

Lyophilized powder

AA Sequence

PPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
BNC940034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-100 1x 100 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
BNC400043-100 1x 100 µL

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-100 1x 100 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-100 1x 100 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details