Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT5 Peptide - middle region

SYT5 Peptide - middle region

Product Specifications

UniProt

O00445

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYT5 Rabbit Polyclonal Antibody (orb584351) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_003171

Preservative

Lyophilized powder

AA Sequence

YLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MPP3 Matched Antibody Pair Set [Poly/RD1110]
Z01LS-1122-LS424 5 Plates

Human MPP3 Matched Antibody Pair Set [Poly/RD1110]

Sign In for Pricing
View Details
POU5F1 (OCT3, OCT4, OTF3, POU Domain, Class 5, Transcription Factor 1, Octamer-binding Protein 3, Octamer-binding Protein 4, Octamer-binding Transcription Factor 3, MGC22487)
146587 100 µg

POU5F1 (OCT3, OCT4, OTF3, POU Domain, Class 5, Transcription Factor 1, Octamer-binding Protein 3, Octamer-binding Protein 4, Octamer-binding Transcription Factor 3, MGC22487)

Sign In for Pricing
View Details
THRA Antibody
A36559-100UL 100 µL

THRA Antibody

Sign In for Pricing
View Details
Dihydralazine Impurity 5
RM-D091205-01 10 mg

Dihydralazine Impurity 5

Sign In for Pricing
View Details
Dihydralazine Impurity 5
RM-D091205-02 100 mg

Dihydralazine Impurity 5

Sign In for Pricing
View Details
Dihydralazine Impurity 5
RM-D091205-03 25 mg

Dihydralazine Impurity 5

Sign In for Pricing
View Details