Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBXT Peptide - N-terminal region

TBXT Peptide - N-terminal region

Product Specifications

Product Name Alternative

T, TFT, SAVA

UniProt

O15178

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBXT Rabbit Polyclonal Antibody (orb574640) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003172

Preservative

Lyophilized powder

AA Sequence

SSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLEESEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP8 Rabbit mAb
AB100577 100 µL

MMP8 Rabbit mAb

Sign In for Pricing
View Details
Rat Tsukushin (TSK) ELISA Kit
MBS9346967-01 48 Well

Rat Tsukushin (TSK) ELISA Kit

Sign In for Pricing
View Details
Rat Tsukushin (TSK) ELISA Kit
MBS9346967-02 96 Well

Rat Tsukushin (TSK) ELISA Kit

Sign In for Pricing
View Details
Rat Tsukushin (TSK) ELISA Kit
MBS9346967-03 5x 96 Well

Rat Tsukushin (TSK) ELISA Kit

Sign In for Pricing
View Details
Rat Tsukushin (TSK) ELISA Kit
MBS9346967-04 10x 96 Well

Rat Tsukushin (TSK) ELISA Kit

Sign In for Pricing
View Details
Zirconium boride, 99+%
GX0433-100g 100 g

Zirconium boride, 99+%

Sign In for Pricing
View Details