Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBXT Peptide - N-terminal region

TBXT Peptide - N-terminal region

Product Specifications

Product Name Alternative

T, TFT, SAVA

UniProt

O15178

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBXT Rabbit Polyclonal Antibody (orb574640) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003172

Preservative

Lyophilized powder

AA Sequence

SSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLEESEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfactomedin 3 (OLFM3) Antibody
abx131375-01 100 µL

Olfactomedin 3 (OLFM3) Antibody

Sign In for Pricing
View Details
Olfactomedin 3 (OLFM3) Antibody
abx131375-02 200 µL

Olfactomedin 3 (OLFM3) Antibody

Sign In for Pricing
View Details
Olfactomedin 3 (OLFM3) Antibody
abx131375-03 1 mL

Olfactomedin 3 (OLFM3) Antibody

Sign In for Pricing
View Details
2- (2,2,3,3-Tetrafluoropropoxy) pyridin-4-amine
BAC09755-01 50 mg

2- (2,2,3,3-Tetrafluoropropoxy) pyridin-4-amine

Sign In for Pricing
View Details
2- (2,2,3,3-Tetrafluoropropoxy) pyridin-4-amine
BAC09755-02 0.5 g

2- (2,2,3,3-Tetrafluoropropoxy) pyridin-4-amine

Sign In for Pricing
View Details
Recombinant Plasmodium Falciparum Tubulin alpha chain Protein (aa 1-453)
VAng-Wyb6882-500gEcoli 500 µg (E. coli)

Recombinant Plasmodium Falciparum Tubulin alpha chain Protein (aa 1-453)

Sign In for Pricing
View Details