TAAR5 Peptide - C-terminal region
TAAR5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MGC138414, MGC138416, PNR, RP11-295F4.5
UniProt
O14804
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TAAR5 Rabbit Polyclonal Antibody (orb584397) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
IF, WB
NCBI Accession Number
NP_003958
Preservative
Lyophilized powder
AA Sequence
TTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4545708 1.0 µg DNA
Srr sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
Sign In for Pricing
View Details 
K1742008 1.0 µg DNA
PSMD2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
P523882 100 µg
Der p 2 Protein (N-His, Dermatophagoides pteronyssinus)
Sign In for Pricing
View Details JBS-NU-812-620 40 µL
8-[ (6-Amino) hexyl]-amino-adenosine-2′,5′-bisphosphate – ATTO-620
Sign In for Pricing
View Details MBS6339983-01 0.1 mL
RAD23B, NT (RAD23B, UV excision repair protein RAD23 homolog B, XP-C repair-complementing complex 58kD protein) (MaxLight 550)
Sign In for Pricing
View Details