Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAAR5 Peptide - middle region

TAAR5 Peptide - middle region

Product Specifications

Product Name Alternative

MGC138414, MGC138416, PNR, RP11-295F4.5

UniProt

Q5QD28

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAAR5 Rabbit Polyclonal Antibody (orb584398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IF, WB

NCBI Accession Number

NP_003958

Preservative

Lyophilized powder

AA Sequence

GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Folic acid PEG-NH2 (5 kDa)
VCar-Ly183 25 mg

Folic acid PEG-NH2 (5 kDa)

Sign In for Pricing
View Details
SFTA3 ORF Vector (Human) (pORF)
ORF032227 1.0 µg DNA

SFTA3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
GTF3C2 Polyclonal Antibody
RD252763A-01 20 µL

GTF3C2 Polyclonal Antibody

Sign In for Pricing
View Details
GTF3C2 Polyclonal Antibody
RD252763A-02 60 μL

GTF3C2 Polyclonal Antibody

Sign In for Pricing
View Details
GTF3C2 Polyclonal Antibody
RD252763A-03 120 μL

GTF3C2 Polyclonal Antibody

Sign In for Pricing
View Details
GTF3C2 Polyclonal Antibody
RD252763A-04 200 µL

GTF3C2 Polyclonal Antibody

Sign In for Pricing
View Details