Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAAR5 Peptide - middle region

TAAR5 Peptide - middle region

Product Specifications

Product Name Alternative

MGC138414, MGC138416, PNR, RP11-295F4.5

UniProt

Q5QD28

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAAR5 Rabbit Polyclonal Antibody (orb584398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IF, WB

NCBI Accession Number

NP_003958

Preservative

Lyophilized powder

AA Sequence

GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Cortexin 3 (CTXN3) ELISA Kit
GTR10315176 96 Well

Guinea Pig Cortexin 3 (CTXN3) ELISA Kit

Sign In for Pricing
View Details
BST2 Antibody
E30AOC253 100 µL

BST2 Antibody

Sign In for Pricing
View Details
OR5W2, CT (OR5W2, OR5W2P, OR5W3P, Olfactory receptor 5W2, Olfactory receptor 5W3, Olfactory receptor OR11-155) (MaxLight 550) discontinued
039463-ML550 100 µL

OR5W2, CT (OR5W2, OR5W2P, OR5W3P, Olfactory receptor 5W2, Olfactory receptor 5W3, Olfactory receptor OR11-155) (MaxLight 550) discontinued

Sign In for Pricing
View Details
NUP210 3'UTR Lenti-reporter-Luc Vector
32322081 1.0 µg

NUP210 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Olr303 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7306205 3x 1.0 µg

Olr303 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
SARDH Polyclonal Antibody
MBS9129190-01 0.02 mL

SARDH Polyclonal Antibody

Sign In for Pricing
View Details