TAC1 Peptide - middle region
TAC1 Peptide - middle region
Product Specifications
Product Name Alternative
Hs.2563, NK2, NKNA, NPK, TAC2
UniProt
P20366
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TAC1 Rabbit Polyclonal Antibody (orb333728) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_054703
Preservative
Lyophilized powder
AA Sequence
MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K3807602 1.0 µg DNA
Saa2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details 
MBS1249121-01 1 mg (E-Coli)
Recombinant Klebsiella pneumoniae Multidrug resistance protein MdtG (mdtG), partial
Sign In for Pricing
View Details MBS1249121-02 1 mg (Yeast)
Recombinant Klebsiella pneumoniae Multidrug resistance protein MdtG (mdtG), partial
Sign In for Pricing
View Details 
EKN48623 96 Tests
Human Suppressor Of Zeste 12 Homolog (SUZ12) ELISA Kit
Sign In for Pricing
View Details MAB12434-500 1 Each
Human IgG Anti SARS-CoV-2 Nucleoprotein Antibody (CR3009)
Sign In for Pricing
View Details