Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Taf6l Peptide - middle region

Taf6l Peptide - middle region

Product Specifications

Product Name Alternative

Taf6l

UniProt

B5DF37

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Taf6l Rabbit Polyclonal Antibody (orb573821) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101045

Preservative

Lyophilized powder

AA Sequence

PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1471 Protein Vector (Rat) (pPM-C-HA)
PV288288 500 ng

Olr1471 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Atl1 qPCR Primer Pair
QM42390S 200 Tests

Mouse Atl1 qPCR Primer Pair

Sign In for Pricing
View Details
Lentiviral human LRRC18 shRNA (UAS) - Lentiviral human LRRC18 shRNA (UAS) (100)
GTR15313269 1 Vial

Lentiviral human LRRC18 shRNA (UAS) - Lentiviral human LRRC18 shRNA (UAS) (100)

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (3H9), CF647 conjugate, 0.1mg/mL
BNC470242-500 1x 500 µL

PTH / Parathyroid Hormone (N-Terminal) (3H9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EPS8 Polyclonal Antibody, Cy5.5 Conjugated
bs-3848R-Cy5.5 100 µL

EPS8 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Anti-p21WAF1 Antibody Clone SPM306, Unconjugated-100ug
1026-MSM2X-P1 100ug

Anti-p21WAF1 Antibody Clone SPM306, Unconjugated-100ug

Sign In for Pricing
View Details