Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Taf6l Peptide - middle region

Taf6l Peptide - middle region

Product Specifications

Product Name Alternative

Taf6l

UniProt

B5DF37

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Taf6l Rabbit Polyclonal Antibody (orb573821) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101045

Preservative

Lyophilized powder

AA Sequence

PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Candida Albicans RPP1B Protein (aa 1-108)
VAng-Lsx05886-50gEcoli 50 µg (E. coli)

Recombinant Candida Albicans RPP1B Protein (aa 1-108)

Sign In for Pricing
View Details
RBM41 Protein Vector (Mouse) (pPM-C-His)
PV222921 500 ng

RBM41 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
mmu-miR-669i miRNA Mimic
MBS8301205-01 5 nmol

mmu-miR-669i miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-669i miRNA Mimic
MBS8301205-02 10 nmol

mmu-miR-669i miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-669i miRNA Mimic
MBS8301205-03 5x 10 nmol

mmu-miR-669i miRNA Mimic

Sign In for Pricing
View Details
Phospho-IKKB (S466) Antibody [APR05262G]
APR05262G-01 50 µL

Phospho-IKKB (S466) Antibody [APR05262G]

Sign In for Pricing
View Details