Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Taf8 Peptide - middle region

Taf8 Peptide - middle region

Product Specifications

Product Name Alternative

AW260255, Tbn

UniProt

Q9EQH4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Taf8 Rabbit Polyclonal Antibody (orb581778) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071298

Preservative

Lyophilized powder

AA Sequence

AKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MNK1 (6P4) Rabbit Monoclonal Antibody
E28G2671 100 µL

MNK1 (6P4) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Triethylenethiophosphoramide-d12
TRC-T776652-1MG 1 mg

Triethylenethiophosphoramide-d12

Sign In for Pricing
View Details
Mouse Monoclonal RASSF1 Antibody (3F3) [Alexa Fluor 405]
NBP1-04342AF405 0.1 mL

Mouse Monoclonal RASSF1 Antibody (3F3) [Alexa Fluor 405]

Sign In for Pricing
View Details
Lentiviral human KLHDC3 shRNA (UAS) - Lentiviral human KLHDC3 shRNA (UAS, iRFP) plasmid
GTR15312295 1 Vial

Lentiviral human KLHDC3 shRNA (UAS) - Lentiviral human KLHDC3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Phospho-c-Abl (Ser569) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-12904R-BF750-01 20 µL

Phospho-c-Abl (Ser569) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Phospho-c-Abl (Ser569) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-12904R-BF750-02 100 µL

Phospho-c-Abl (Ser569) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details