Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Taf8 Peptide - middle region

Taf8 Peptide - middle region

Product Specifications

Product Name Alternative

AW260255, Tbn

UniProt

Q9EQH4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Taf8 Rabbit Polyclonal Antibody (orb581778) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071298

Preservative

Lyophilized powder

AA Sequence

AKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELOF1 Antibody
A20525-100UL 100 µL

ELOF1 Antibody

Sign In for Pricing
View Details
EphA7 Protein, Mouse, Recombinant (His Tag)
MBS8122849-01 0.2 mg

EphA7 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
EphA7 Protein, Mouse, Recombinant (His Tag)
MBS8122849-02 5x 0.2 mg

EphA7 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
SOX9 (SRY (Sex Determining Region Y)-Box 9, CMD1, CMPD1, SRA1) (MaxLight 405)
MBS6198004-01 0.1 mL

SOX9 (SRY (Sex Determining Region Y)-Box 9, CMD1, CMPD1, SRA1) (MaxLight 405)

Sign In for Pricing
View Details
SOX9 (SRY (Sex Determining Region Y)-Box 9, CMD1, CMPD1, SRA1) (MaxLight 405)
MBS6198004-02 5x 0.1 mL

SOX9 (SRY (Sex Determining Region Y)-Box 9, CMD1, CMPD1, SRA1) (MaxLight 405)

Sign In for Pricing
View Details
PCDH11X Antibody (Biotin)
orb418454-01 50 µg

PCDH11X Antibody (Biotin)

Sign In for Pricing
View Details