Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tagln Peptide - C-terminal region

Tagln Peptide - C-terminal region

Product Specifications

Product Name Alternative

Sm22

UniProt

P31232

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tagln Rabbit Polyclonal Antibody (orb330541) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_113737

Preservative

Lyophilized powder

AA Sequence

KNDGHYRGDPNWFMKKAQEHKREFTDSQLQEGKHVIGLQMGSNRGASQAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDN3 Antibody
KC-2308-01 50 μL

CLDN3 Antibody

Sign In for Pricing
View Details
CLDN3 Antibody
KC-2308-02 100 µL

CLDN3 Antibody

Sign In for Pricing
View Details
CLDN3 Antibody
KC-2308-03 1 mL

CLDN3 Antibody

Sign In for Pricing
View Details
Desacetyl Pyrifluquinazon
TRC-D374185-50MG 50 mg

Desacetyl Pyrifluquinazon

Sign In for Pricing
View Details
2-Fluoroephedrone Hydrochloride
TRC-F591570-50MG 50 mg

2-Fluoroephedrone Hydrochloride

Sign In for Pricing
View Details
Syne4 Mouse Gene Knockout Kit (CRISPR)
KN517058 1 Kit

Syne4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details