Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tagln Peptide - C-terminal region

Tagln Peptide - C-terminal region

Product Specifications

Product Name Alternative

Sm22

UniProt

P31232

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tagln Rabbit Polyclonal Antibody (orb330541) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_113737

Preservative

Lyophilized powder

AA Sequence

KNDGHYRGDPNWFMKKAQEHKREFTDSQLQEGKHVIGLQMGSNRGASQAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C7orf16 (PPP1R17) (NM_006658) Human Recombinant Protein
TP307007L 1 mg

C7orf16 (PPP1R17) (NM_006658) Human Recombinant Protein

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PAb1801), 1mg/mL
BNUM1916-50 1x 50 µL

P53 Tumor Suppressor Protein (PAb1801), 1mg/mL

Sign In for Pricing
View Details
4,5-Dichlorophthalic Anhydride
TRC-D473963-5G 5 g

4,5-Dichlorophthalic Anhydride

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS648740 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
IL 4 Mouse
OM296542-01 5 µg

IL 4 Mouse

Sign In for Pricing
View Details
IL 4 Mouse
OM296542-02 20 µg

IL 4 Mouse

Sign In for Pricing
View Details