Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tagln3 Peptide - N-terminal region

Tagln3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2700038H05Rik, 2900005O10Rik, AI426007, Np25

UniProt

Q9R1Q8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tagln3 Rabbit Polyclonal Antibody (orb582319) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062728

Preservative

Lyophilized powder

AA Sequence

WLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAEVYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRAF Recombinant Rabbit Monoclonal Antibody [JE62-23]
HA722409 100 µL

GRAF Recombinant Rabbit Monoclonal Antibody [JE62-23]

Sign In for Pricing
View Details
HSD17B13 (NM_178135) Human Recombinant Protein
TP313132L 1 mg

HSD17B13 (NM_178135) Human Recombinant Protein

Sign In for Pricing
View Details
LAMP1 Mouse Monoclonal Antibody [Clone ID: 5H6]
AM32995PU-N 100 µL

LAMP1 Mouse Monoclonal Antibody [Clone ID: 5H6]

Sign In for Pricing
View Details
Ethyl 3-Pyridylacetate
TRC-E925870-25G 25 g

Ethyl 3-Pyridylacetate

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR560890 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
CD6 (3F7B5), 0.2mg/mL
BNUB0428-100 1x 100 µL

CD6 (3F7B5), 0.2mg/mL

Sign In for Pricing
View Details