Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAPBP Peptide - N-terminal region

TAPBP Peptide - N-terminal region

Product Specifications

Product Name Alternative

NGS17, TAPA, TPN, TPSN

UniProt

O15533

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAPBP Rabbit Polyclonal Antibody (orb579462) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_757345

Preservative

Lyophilized powder

AA Sequence

GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Jejunum
CS702764 5x 5 µm

Tissue FFPE Sections, Jejunum

Sign In for Pricing
View Details
Human WDR54 activation kit by CRISPRa
GA113342 1 Kit

Human WDR54 activation kit by CRISPRa

Sign In for Pricing
View Details
HLA-DRB1 Rabbit Polyclonal Antibody
TA377115 100 µL

HLA-DRB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mitochondria (Marker for Human Cells, Granular RCC's & Salivary Tumors) (MTC02/2860R), CF640R conjugate, 0.1mg/mL
BNC402860-500 1x 500 µL

Mitochondria (Marker for Human Cells, Granular RCC's & Salivary Tumors) (MTC02/2860R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human PLA2G2D Protein (Fc Tag)
PKSH030829-01 100 µg

Recombinant Human PLA2G2D Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human PLA2G2D Protein (Fc Tag)
PKSH030829-02 1 mg

Recombinant Human PLA2G2D Protein (Fc Tag)

Sign In for Pricing
View Details