Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D10A Peptide - C-terminal region

TBC1D10A Peptide - C-terminal region

Product Specifications

Product Name Alternative

EPI64, TBC1D10, dJ130H16.1, dJ130H16.2

UniProt

Q9BXI6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D10A Rabbit Polyclonal Antibody (orb584726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114143

Preservative

Lyophilized powder

AA Sequence

GRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Human T Cell T6,  5nm
GM-20-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human T Cell T6, 5nm

Sign In for Pricing
View Details
ENTPD5 Recombinant Rabbit Monoclonal Antibody [JE47-87]
ET7109-70 100 µL

ENTPD5 Recombinant Rabbit Monoclonal Antibody [JE47-87]

Sign In for Pricing
View Details
Annexin VII (ANXA7) (NM_001156) Human Over-expression Lysate
LY400464 100 µg

Annexin VII (ANXA7) (NM_001156) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit
E-EL-R3027-01 24 Tests

Rat SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit

Sign In for Pricing
View Details
Rat SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit
E-EL-R3027-02 48 Tests

Rat SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit

Sign In for Pricing
View Details
Rat SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit
E-EL-R3027-03 96 Tests

Rat SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit

Sign In for Pricing
View Details