Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D10A Peptide - C-terminal region

TBC1D10A Peptide - C-terminal region

Product Specifications

Product Name Alternative

EPI64, TBC1D10, dJ130H16.1, dJ130H16.2

UniProt

Q9BXI6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D10A Rabbit Polyclonal Antibody (orb584726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114143

Preservative

Lyophilized powder

AA Sequence

GRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PAFAH1B3 activation kit by CRISPRa
GA103372 1 Kit

Human PAFAH1B3 activation kit by CRISPRa

Sign In for Pricing
View Details
PDP1 (NM_001161781) Human Over-expression Lysate
LC431974 20 µg

PDP1 (NM_001161781) Human Over-expression Lysate

Sign In for Pricing
View Details
Human AMBRA1 activation kit by CRISPRa
GA110835 1 Kit

Human AMBRA1 activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Bright™ Violet 421 Anti-Mouse CD8a Antibody[53-6.7]
E-AB-F1104Q2 50 Tests

Elab Bright™ Violet 421 Anti-Mouse CD8a Antibody[53-6.7]

Sign In for Pricing
View Details
Human Receptor Interacting Serine Threonine Kinase 1 (RIPK1) ELISA Kit
RD-RIPK1-Hu-01 96 Tests

Human Receptor Interacting Serine Threonine Kinase 1 (RIPK1) ELISA Kit

Sign In for Pricing
View Details
Human Receptor Interacting Serine Threonine Kinase 1 (RIPK1) ELISA Kit
RD-RIPK1-Hu-02 48 Tests

Human Receptor Interacting Serine Threonine Kinase 1 (RIPK1) ELISA Kit

Sign In for Pricing
View Details