Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D19 Peptide - middle region

TBC1D19 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ11082

UniProt

Q8N5T2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D19 Rabbit Polyclonal Antibody (orb326157) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060787

Preservative

Lyophilized powder

AA Sequence

PVYAPKDFLEVLINLRNPNYENGDSLSFRTHLGLIQVPLKVKDIPELKEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PT7-MCS-10xHis Plasmid
PVT71222 2 µg

PT7-MCS-10xHis Plasmid

Sign In for Pricing
View Details
KAL1 Polyclonal Antibody, Cy3 Conjugated
bs-11053R-Cy3 100 µL

KAL1 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Amine dehydrogenases kit
EA183201 50 mg

Amine dehydrogenases kit

Sign In for Pricing
View Details
Anti-PHIP Antibody Picoband® Fluoro647 Conjugated
A01555-1-Fluoro647 100 µg/Vial

Anti-PHIP Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Cathepsin D (Tumor Marker) (CTSD/3275), 0.2mg/mL
BNUB3275-100 1x 100 µL

Cathepsin D (Tumor Marker) (CTSD/3275), 0.2mg/mL

Sign In for Pricing
View Details
Nol12 Mouse Gene Knockout Kit (CRISPR)
KN511101 1 Kit

Nol12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details