Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D19 Peptide - middle region

TBC1D19 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ11082

UniProt

Q8N5T2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D19 Rabbit Polyclonal Antibody (orb326157) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060787

Preservative

Lyophilized powder

AA Sequence

PVYAPKDFLEVLINLRNPNYENGDSLSFRTHLGLIQVPLKVKDIPELKEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (dihydroxyboranyl) -2,3-difluorobenzoic acid
429503-01 100 mg

4- (dihydroxyboranyl) -2,3-difluorobenzoic acid

Sign In for Pricing
View Details
4- (dihydroxyboranyl) -2,3-difluorobenzoic acid
429503-02 250 mg

4- (dihydroxyboranyl) -2,3-difluorobenzoic acid

Sign In for Pricing
View Details
Host cell factor C1 regµLator 1 (HCFC1R1) Human siRNA Oligo Duplex (Locus ID 54985)
SR310402 1 Kit

Host cell factor C1 regµLator 1 (HCFC1R1) Human siRNA Oligo Duplex (Locus ID 54985)

Sign In for Pricing
View Details
NO66 Peptide
orb1233331 0.1 mg

NO66 Peptide

Sign In for Pricing
View Details
Human PTPN11 Antibody : FITC (Phospho-Tyr580)
OAAQ00088-10T 10 Tests

Human PTPN11 Antibody : FITC (Phospho-Tyr580)

Sign In for Pricing
View Details
Recombinant Shigella Flexneri glyA Protein (aa 1-417)
VAng-Lsx07804-50gEcoli 50 µg (E. coli)

Recombinant Shigella Flexneri glyA Protein (aa 1-417)

Sign In for Pricing
View Details