Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D20 Peptide - C-terminal region

TBC1D20 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf140, FLJ45119

UniProt

Q96BZ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D20 Rabbit Polyclonal Antibody (orb585407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653229

Preservative

Lyophilized powder

AA Sequence

ERTAASTFKDFELASAQQRPDMVLRQRFRGLLRPEDRTKDVLTKPRTNRF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse SEZ6 Protein
orb2992938-01 10 µg

Recombinant Mouse SEZ6 Protein

Sign In for Pricing
View Details
Recombinant Mouse SEZ6 Protein
orb2992938-02 50 µg

Recombinant Mouse SEZ6 Protein

Sign In for Pricing
View Details
Recombinant Mouse SEZ6 Protein
orb2992938-03 500 µg

Recombinant Mouse SEZ6 Protein

Sign In for Pricing
View Details
Recombinant Mouse SEZ6 Protein
orb2992938-04 1 mg

Recombinant Mouse SEZ6 Protein

Sign In for Pricing
View Details
Charybdotoxin peptide
orb2999637 5 mg

Charybdotoxin peptide

Sign In for Pricing
View Details
Anti-Raf-B antibody
STJ95349 200 µl

Anti-Raf-B antibody

Sign In for Pricing
View Details