Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D20 Peptide - C-terminal region

TBC1D20 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf140, FLJ45119

UniProt

Q96BZ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D20 Rabbit Polyclonal Antibody (orb585407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653229

Preservative

Lyophilized powder

AA Sequence

ERTAASTFKDFELASAQQRPDMVLRQRFRGLLRPEDRTKDVLTKPRTNRF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3.1 (HIST1H3J, Histone H3K27me1, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, Histone H3/k, Histone H3/l, HIST3H3) (APC)
MBS6420546-01 0.1 mL

Histone H3.1 (HIST1H3J, Histone H3K27me1, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, Histone H3/k, Histone H3/l, HIST3H3) (APC)

Sign In for Pricing
View Details
Histone H3.1 (HIST1H3J, Histone H3K27me1, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, Histone H3/k, Histone H3/l, HIST3H3) (APC)
MBS6420546-02 5x 0.1 mL

Histone H3.1 (HIST1H3J, Histone H3K27me1, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, Histone H3/k, Histone H3/l, HIST3H3) (APC)

Sign In for Pricing
View Details
Recombinant Human CD121b/IL1R2/IL-2R beta Protein, C-Fc
orb3152906-01 50 µg

Recombinant Human CD121b/IL1R2/IL-2R beta Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human CD121b/IL1R2/IL-2R beta Protein, C-Fc
orb3152906-02 100 µg

Recombinant Human CD121b/IL1R2/IL-2R beta Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human CD121b/IL1R2/IL-2R beta Protein, C-Fc
orb3152906-03 1 mg

Recombinant Human CD121b/IL1R2/IL-2R beta Protein, C-Fc

Sign In for Pricing
View Details
Lacc1 Mouse siRNA Oligo Duplex (Locus ID 210808)
SR414212 1 Kit

Lacc1 Mouse siRNA Oligo Duplex (Locus ID 210808)

Sign In for Pricing
View Details