Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D24 Peptide - middle region

TBC1D24 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1171, MGC102885, FIME

UniProt

Q9ULP9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D24 Rabbit Polyclonal Antibody (orb326202) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065756

Preservative

Lyophilized powder

AA Sequence

SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OKRC01293-96W - Renin 1 ELISA Kit (Mouse)
OKRC01293-96W 96 Well

OKRC01293-96W - Renin 1 ELISA Kit (Mouse)

Sign In for Pricing
View Details
IL1RAPL1 Rabbit Polyclonal Antibody (Biotin)
orb457485 100 µL

IL1RAPL1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
STNL M020-297x105-AL-CRD/1 AC Signs
820857 Card of 1 Pictogram(s)

STNL M020-297x105-AL-CRD/1 AC Signs

Sign In for Pricing
View Details
Eif2c2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4142502 1.0 µg DNA

Eif2c2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Mouse Monoclonal Granzyme B Antibody (GB11) [Alexa Fluor 594]
NB100-64774AF594 0.1 mL

Mouse Monoclonal Granzyme B Antibody (GB11) [Alexa Fluor 594]

Sign In for Pricing
View Details
Camel Transmembrane Protein 27 ELISA Kit
MBS070429-01 48 Well

Camel Transmembrane Protein 27 ELISA Kit

Sign In for Pricing
View Details