Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D24 Peptide - middle region

TBC1D24 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1171, MGC102885, FIME

UniProt

Q9ULP9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D24 Rabbit Polyclonal Antibody (orb326202) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065756

Preservative

Lyophilized powder

AA Sequence

SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human R3H domain-containing protein 2, R3HDM2 ELISA Kit
MBS9328747-01 48 Well

Human R3H domain-containing protein 2, R3HDM2 ELISA Kit

Sign In for Pricing
View Details
Human R3H domain-containing protein 2, R3HDM2 ELISA Kit
MBS9328747-02 96 Well

Human R3H domain-containing protein 2, R3HDM2 ELISA Kit

Sign In for Pricing
View Details
Human R3H domain-containing protein 2, R3HDM2 ELISA Kit
MBS9328747-03 5x 96 Well

Human R3H domain-containing protein 2, R3HDM2 ELISA Kit

Sign In for Pricing
View Details
Human R3H domain-containing protein 2, R3HDM2 ELISA Kit
MBS9328747-04 10x 96 Well

Human R3H domain-containing protein 2, R3HDM2 ELISA Kit

Sign In for Pricing
View Details
Nlrp1a Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV640804 1.0 µg DNA

Nlrp1a Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
FGFR2 C491S Recombinant Human Active Protein Kinase
HY-E70814 1 Each

FGFR2 C491S Recombinant Human Active Protein Kinase

Sign In for Pricing
View Details