Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D2B Peptide - C-terminal region

TBC1D2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ20166, KIAA1055

UniProt

Q9UPU7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D2B Rabbit Polyclonal Antibody (orb324387) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055894

Preservative

Lyophilized powder

AA Sequence

EDALQVESQEQPEQAFVKPHLVSEYDIYGFRTVPEDDEEEKLVAKVRALD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2121), CF740 conjugate, 0.1mg/mL
BNC742121-500 1x 500 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2121), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Polystyrene A PHB
HA12516013.100G 100 g

Polystyrene A PHB

Sign In for Pricing
View Details
Cytokeratin 5/6/18 (LP34), CF568 conjugate, 0.1mg/mL
BNC682036-100 1x 100 µL

Cytokeratin 5/6/18 (LP34), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human LAMP1/CD107a Protein (His Tag)
PKSH031205 100 µg

Recombinant Human LAMP1/CD107a Protein (His Tag)

Sign In for Pricing
View Details
TEX2 Polyclonal Antibody
E-AB-90926-01 60 µL

TEX2 Polyclonal Antibody

Sign In for Pricing
View Details
TEX2 Polyclonal Antibody
E-AB-90926-02 120 µL

TEX2 Polyclonal Antibody

Sign In for Pricing
View Details