Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D2B Peptide - C-terminal region

TBC1D2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ20166, KIAA1055

UniProt

Q9UPU7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D2B Rabbit Polyclonal Antibody (orb324387) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055894

Preservative

Lyophilized powder

AA Sequence

EDALQVESQEQPEQAFVKPHLVSEYDIYGFRTVPEDDEEEKLVAKVRALD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPCAT1 (NM_024830) Human Recombinant Protein
TP320083L 1 mg

LPCAT1 (NM_024830) Human Recombinant Protein

Sign In for Pricing
View Details
CD69 Mouse Monoclonal Antibody [A8C4]
HA601013 100 µL

CD69 Mouse Monoclonal Antibody [A8C4]

Sign In for Pricing
View Details
Bisphenol AP-d5
TRC-B519488-1MG 1 mg

Bisphenol AP-d5

Sign In for Pricing
View Details
OR4B1 Human Gene Knockout Kit (CRISPR)
KN419783 1 Kit

OR4B1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NUDT21 Mouse Monoclonal Antibody [Clone ID: OTI2C8]
CF805829 100 µg

NUDT21 Mouse Monoclonal Antibody [Clone ID: OTI2C8]

Sign In for Pricing
View Details
CD137L / 4-1BBL / TNFSF9 (CD137L/1547), CF594 conjugate, 0.1mg/mL
BNC941547-500 1x 500 µL

CD137L / 4-1BBL / TNFSF9 (CD137L/1547), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details