Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbcb Peptide - N-terminal region

Tbcb Peptide - N-terminal region

Product Specifications

Product Name Alternative

2410007D12Rik, AU041393, CG22, CKAPI, Ckap1

UniProt

Q9D1E6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tbcb Rabbit Polyclonal Antibody (orb581501) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079824

Preservative

Lyophilized powder

AA Sequence

FKCKLELVVGSPASCMELELYGADDKFYSKLDQEDALLGSYPVDDGCRIH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GH2 (NM_002059) Human Over-expression Lysate
LC419565 20 µg

GH2 (NM_002059) Human Over-expression Lysate

Sign In for Pricing
View Details
Spastin (Sp 6C6), CF740 conjugate, 0.1mg/mL
BNC743070-500 1x 500 µL

Spastin (Sp 6C6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KDM4A Recombinant Rabbit monoclonal Antibody
HA750901 100 µL

KDM4A Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
N6AMT2 (EEF1AKMT1) (NM_174928) Human Recombinant Protein
TP305604L 1 mg

N6AMT2 (EEF1AKMT1) (NM_174928) Human Recombinant Protein

Sign In for Pricing
View Details
PFKFB1 (NM_002625) Human Recombinant Protein
TP324599M 100 µg

PFKFB1 (NM_002625) Human Recombinant Protein

Sign In for Pricing
View Details
Benzyl 2,3,4-Tri-O-benzyl-Alpha-D-glucopyranoside
TRC-B315845-25MG 25 mg

Benzyl 2,3,4-Tri-O-benzyl-Alpha-D-glucopyranoside

Sign In for Pricing
View Details