Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBRG4 Peptide - C-terminal region

TBRG4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CPR2, FASTKD4, KIAA0948

UniProt

Q969Z0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBRG4 Rabbit Polyclonal Antibody (orb585469) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112162

Preservative

Lyophilized powder

AA Sequence

PEFHIQFLGGKSQKDQNTFQKLLHINATALLEYPEYSGPLLPASAVAPGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAD4 (Pancreatic Adenocarcinoma Marker) (SMAD4/2524), Biotin conjugate, 0.1mg/mL
BNCB2524-500 1x 500 µL

SMAD4 (Pancreatic Adenocarcinoma Marker) (SMAD4/2524), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calbryte™-520L, potassium salt
20642-AAT 10x 50 µg

Calbryte™-520L, potassium salt

Sign In for Pricing
View Details
TMEM43 Rabbit Polyclonal Antibody
TA382610 100 µL

TMEM43 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS638912 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Vmn1r101 Mouse Gene Knockout Kit (CRISPR)
KN518907 1 Kit

Vmn1r101 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant TFAP2C Antibody
RC-4386-01 50 μL

Recombinant TFAP2C Antibody

Sign In for Pricing
View Details