Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBRG4 Peptide - C-terminal region

TBRG4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CPR2, FASTKD4, KIAA0948

UniProt

Q969Z0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBRG4 Rabbit Polyclonal Antibody (orb585469) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112162

Preservative

Lyophilized powder

AA Sequence

PEFHIQFLGGKSQKDQNTFQKLLHINATALLEYPEYSGPLLPASAVAPGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HDAC10 Antibody
RC-15479-01 50 μL

Recombinant HDAC10 Antibody

Sign In for Pricing
View Details
Recombinant HDAC10 Antibody
RC-15479-02 100 µL

Recombinant HDAC10 Antibody

Sign In for Pricing
View Details
Recombinant HDAC10 Antibody
RC-15479-03 1 mL

Recombinant HDAC10 Antibody

Sign In for Pricing
View Details
APC Anti-Human CD11c Antibody[BU15]
E-AB-F1118E-01 20 Tests

APC Anti-Human CD11c Antibody[BU15]

Sign In for Pricing
View Details
APC Anti-Human CD11c Antibody[BU15]
E-AB-F1118E-02 100 Tests

APC Anti-Human CD11c Antibody[BU15]

Sign In for Pricing
View Details
APC Anti-Human CD11c Antibody[BU15]
E-AB-F1118E-03 2x 100 Tests

APC Anti-Human CD11c Antibody[BU15]

Sign In for Pricing
View Details