Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbx22 Peptide - N-terminal region

Tbx22 Peptide - N-terminal region

Product Specifications

Product Name Alternative

D230020M15Rik

UniProt

Q8K402

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tbx22 Rabbit Polyclonal Antibody (orb576323) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660259

Preservative

Lyophilized powder

AA Sequence

SVEALMGRPSKRKAQDPREEMQPELQEEQFVEEGEEILRSPSRDSQQPEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-500 1x 500 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
BNC740149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-100 1x 100 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
BNC470679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL
BNC940669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details