Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcea1 Peptide - N-terminal region

Tcea1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC103154, S-II

UniProt

P10711

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tcea1 Rabbit Polyclonal Antibody (orb576224) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035671

Preservative

Lyophilized powder

AA Sequence

NALRKQSTDEEVTSLAKSLIKSWKKLLDGPSTDKDPEEKKKEPAISSQNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC4A9 activation kit by CRISPRa
GA113239 1 Kit

Human SLC4A9 activation kit by CRISPRa

Sign In for Pricing
View Details
Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]
TA501418AM 100 µL

Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]

Sign In for Pricing
View Details
CD161 (KLRB1) (NM_002258) Human Over-expression Lysate
LY419438 100 µg

CD161 (KLRB1) (NM_002258) Human Over-expression Lysate

Sign In for Pricing
View Details
Nitecapone-13C5
TRC-N490132-0.5MG 0.5 mg

Nitecapone-13C5

Sign In for Pricing
View Details
OIF (OGN) (NM_033014) Human Over-expression Lysate
LY403216 100 µg

OIF (OGN) (NM_033014) Human Over-expression Lysate

Sign In for Pricing
View Details
WIPI2 (C-term) Rabbit Polyclonal Antibody
AP54567PU-N 400 µL

WIPI2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details