Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcea1 Peptide - N-terminal region

Tcea1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC103154, S-II

UniProt

P10711

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tcea1 Rabbit Polyclonal Antibody (orb576224) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035671

Preservative

Lyophilized powder

AA Sequence

NALRKQSTDEEVTSLAKSLIKSWKKLLDGPSTDKDPEEKKKEPAISSQNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

tert-Butyl Isopropyl Ether
TRC-B692450-1G 1 g

tert-Butyl Isopropyl Ether

Sign In for Pricing
View Details
Fumaryl Chloride
TRC-F860880-5G 5 g

Fumaryl Chloride

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS710433 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS626919 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
NMD3 (C-term) Rabbit Polyclonal Antibody
AP11767PU-N 400 µL

NMD3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DCP1A Human Gene Knockout Kit (CRISPR)
KN401330 1 Kit

DCP1A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details